DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and cpg-2

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:241 Identity:54/241 - (22%)
Similarity:84/241 - (34%) Gaps:55/241 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DVFDECNDGNNLSFVTSPKSC-AHYIFCNGDESYDGECEDGEYFSQDMEMC-------EPMGDID 79
            :|.:...||     ..|...| .:|.||..:.:....|....::..|.:.|       |...|:.
 Worm   136 NVCENLEDG-----AYSSGGCTTYYFFCTTNTARFLSCPTPLFYDADSQKCIWKSLVEECKEDLT 195

  Fly    80 CRTGS-EVQRENTTDSS-------STEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTS 136
            ...|| |...|.:.::|       |.|.:.|||                      .|....::..
 Worm   196 ITDGSGETSGEGSGEASGEASGEGSGEASGESS----------------------GQGSGEASGE 238

  Fly   137 VSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKCDHPEN 201
            .|..:|       |..:.::. .:.||....:::..|..|:|..|.|..||.||.....||.|.:
 Worm   239 GSGELE-------PTCEGKAD-GIHPNGVCSTNFLTCSGGIARIMDCPASLVFNPTILVCDWPRD 295

  Fly   202 VRCLAMTYNPREQCKRHVIDVYPHSDNC-NYFYQCRSGYLMVQQCP 246
            |...|....|:..|:.   |.|.....| :.|..|.:|..:|..||
 Worm   296 VAECAGLPTPQPTCEE---DGYFSFGQCSSSFTACTNGRAIVMFCP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 10/53 (19%)
CBM_14 160..202 CDD:279884 14/41 (34%)
ChtBD2 215..259 CDD:214696 10/33 (30%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884
CBM_14 138..190 CDD:279884 10/56 (18%)
ChtBD2 245..293 CDD:214696 14/48 (29%)
CBM_14 311..359 CDD:279884 9/31 (29%)
CBM_14 403..454 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.