DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and Gm30500

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017171830.1 Gene:Gm30500 / 102632425 MGIID:5589659 Length:614 Species:Mus musculus


Alignment Length:151 Identity:37/151 - (24%)
Similarity:49/151 - (32%) Gaps:57/151 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CSDYYICYRGVALPMSCATSLHFNSLTGK-----------CDHPENVR------CLAMTYNPRE- 213
            |...:.|.||.:||..|... .:.||.|:           |  |||:.      |.|..|.||. 
Mouse   176 CPQGHFCPRGTSLPQPCRAG-SYGSLLGQVSCFPCPAGYYC--PENITSYSGYPCPAGFYCPRGT 237

  Fly   214 ------QCKRHVIDVYP--HS-DNCNYFYQCRSGYLMVQQ------CPFFYGW------------ 251
                  .|.|...:..|  || |:|   ..|..|:...|:      .|...||            
Mouse   238 KHAAQFPCPRGYYNPDPLTHSLDSC---LPCPPGHYCGQENLTKPSGPCDAGWYCVSAAWNARPF 299

  Fly   252 ---DYEKRSCVALGQA---KC 266
               :|...:|:....|   ||
Mouse   300 DLDNYTSTNCLCPATATGGKC 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 13/45 (29%)
ChtBD2 215..259 CDD:214696 14/67 (21%)
Gm30500XP_017171830.1 TNFRSF 394..518 CDD:389949
CRD1 394..411 CDD:276900
CRD2 414..451 CDD:276900
CRD3 453..506 CDD:276900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.