DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33985 and CG42728

DIOPT Version :9

Sequence 1:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:104 Identity:33/104 - (31%)
Similarity:52/104 - (50%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 QNS--CSDYYICYRGVA----LPMSCATSLHFNSLTGKCDHPENVRCLAMTYNP---REQCKRHV 219
            |||  |:|...|.....    ||:..:|:|..::.      |..|...:.|.:|   |.:|::.|
  Fly    55 QNSMFCTDNTTCNANFTCSDILPVDNSTALPISTT------PNVVTTASTTVSPSDIRRECRQGV 113

  Fly   220 IDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSC 258
            ...:.:..||||||.|..|:|:|:|||..|.:|.:..:|
  Fly   114 TKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884
CBM_14 160..202 CDD:279884 11/43 (26%)
ChtBD2 215..259 CDD:214696 18/44 (41%)
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 15/34 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.