Sequence 1: | NP_001034017.2 | Gene: | CG33986 / 3885638 | FlyBaseID: | FBgn0053986 | Length: | 277 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262662.1 | Gene: | Mur89F / 42080 | FlyBaseID: | FBgn0038492 | Length: | 2159 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 45/202 - (22%) |
---|---|---|---|
Similarity: | 69/202 - (34%) | Gaps: | 60/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 TAQLTWRPSKPTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGDA----VLASCPPTM 77
Fly 78 LFNSESRLCDSATNVKCRNETDPIETPPF-------DGGNGDGDPNNMVTDAATYCSTLVEQQQS 135
Fly 136 SDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSG 200
Fly 201 FPSGGTA 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33986 | NP_001034017.2 | CBM_14 | 41..92 | CDD:279884 | 16/54 (30%) |
CBM_14 | 141..185 | CDD:279884 | 7/43 (16%) | ||
ChtBD2 | 213..261 | CDD:214696 | |||
Mur89F | NP_001262662.1 | CBM_14 | 57..106 | CDD:279884 | |
CBM_14 | 200..250 | CDD:279884 | |||
CBM_14 | 484..536 | CDD:279884 | |||
CBM_14 | 745..798 | CDD:279884 | |||
CBM_14 | 1025..1074 | CDD:279884 | 17/69 (25%) | ||
CBM_14 | 1206..1261 | CDD:279884 | |||
CBM_14 | 1336..1388 | CDD:279884 | |||
CBM_14 | 1523..1577 | CDD:279884 | |||
VAD1-2 | <1599..>1656 | CDD:291956 | |||
CBM_14 | 1809..1861 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |