DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG17147

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:270 Identity:59/270 - (21%)
Similarity:96/270 - (35%) Gaps:68/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLATAQLTWRPSKPTNSVTIRQSGSRICANH---LVGEFVEHAEDCHMFYLCVENGDAVLASCPP 75
            |...:..::.|||.:...|:..| ::.|.|.   |.||:|....:||.::.|: ||..:...||.
  Fly    61 LTCPSNQSFNPSKGSCVDTLANS-NKYCGNRCEGLDGEWVADPTECHKYFYCM-NGVPLAGMCPV 123

  Fly    76 TMLFNSESRLCDSATNVKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIV 140
            ...|:..|:.|....:..|                  .|.||:       |..:.|..:      
  Fly   124 GQHFDERSQSCLYGVDSMC------------------VDVNNI-------CELVAENTK------ 157

  Fly   141 YVGSSSSCRKYYIC-YYGQAILQECS----SQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSG 200
             ..:...|..||.| ..|....:.|:    .:.:::..:|.|....:.:||...:|::.|:..: 
  Fly   158 -FRNEKDCAYYYECDKTGNHASKSCTVTSKKREYFDVESGNCVEANKVECTAHSKENVCTSSTT- 220

  Fly   201 FPSGGTAISSDLIHCPAY--GQHLYPHMQRCEFFIYCVKGHASLQ----QCPFYYFFDIATKSCQ 259
                 ....||...|..|  .:.|||              .|.|.    |||..||||...:.|.
  Fly   221 -----MTFKSDQATCRGYFVCKALYP--------------VADLDPLWTQCPEGYFFDEDRQLCA 266

  Fly   260 WSRTAQCVRD 269
            ...|..|..:
  Fly   267 NPTTVVCTHN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 16/53 (30%)
CBM_14 141..185 CDD:279884 8/48 (17%)
ChtBD2 213..261 CDD:214696 15/53 (28%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 4/15 (27%)
ChtBD2 89..136 CDD:214696 15/47 (32%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.