DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG6933

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:299 Identity:61/299 - (20%)
Similarity:103/299 - (34%) Gaps:86/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LNTAFYLIVNCLLATAQLTWRPSKPTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGD 67
            :|....::..|||..:|.|        ..|:    ..:|.......::.:..:||.:..|.....
  Fly    16 INMRICVVAACLLMASQAT--------GYTM----DDLCQQWSGYGYIGNPSNCHAWGYCKNQEV 68

  Fly    68 AVLASCPPTMLFNSESRLCDSATNVKCRNETDPIET------PPF-------------DG----G 109
            ....:||..::||:::..||.|....|  .|..:||      |.:             ||    .
  Fly    69 VAWGTCPNGLVFNAQAGSCDYANTTVC--STSAVETCSNVKSPMYVANPLNCTEYAYCDGTGQIS 131

  Fly   110 NGDGDPNNMVTDAATYC--------STLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSS 166
            .||.....:.:.::|.|        .|:.....|:   ::||..:.|..|..|..|....::|||
  Fly   132 YGDCGTGGVYSASSTKCIWGPACPQDTICRFMLSN---IFVGDPNQCGNYINCVNGYGTSEKCSS 193

  Fly   167 QL--HWNAMTGKCDI--PERAQCTVGGQEDMPTNGNSGFPS--------------GGTAIS---- 209
            ..  ::|..||.|..  |...:.:..|..|..|.|.:...:              .|.::.    
  Fly   194 TANPYYNKATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNGESVDYRYV 258

  Fly   210 SDLIHCPAYGQHLYPHMQRCEFFIYCVKGHAS--LQQCP 246
            ||.:.|  ||            :.||...:|:  ..|||
  Fly   259 SDGVTC--YG------------YYYCAAVNATGYWNQCP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 11/50 (22%)
CBM_14 141..185 CDD:279884 14/47 (30%)
ChtBD2 213..261 CDD:214696 9/36 (25%)
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.