DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG7290

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:230 Identity:54/230 - (23%)
Similarity:75/230 - (32%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SGSRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDP 100
            |.|..|....||.|...:..|..:|.|..:| ||..:||....||..:..|....|..|....  
  Fly    86 SNSDPCLGKAVGSFAASSSSCGGYYYCGASG-AVRGNCPAGENFNPTTMACVYKNNYPCSESA-- 147

  Fly   101 IETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECS 165
                      |||   :.|:.|...|: ||:..      .|.||.|.|..:..|.........|.
  Fly   148 ----------GDG---STVSVALNLCN-LVKNG------FYFGSPSDCSGWNFCQDNVLHSGSCE 192

  Fly   166 SQLHWNAMTGKCDIPERAQC-------TVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAYGQHLY 223
            ..|.:|.....|.....:.|       ::.|.....|..:||.....||                
  Fly   193 DGLVFNVQASNCGYKMASSCAQVTNDPSLTGVSAPTTCSSSGATIAATA---------------- 241

  Fly   224 PHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSC 258
                 |..:..|..|:..|..||..|::|..:|:|
  Fly   242 -----CNQYYLCSAGNYQLMTCPSGYYYDTISKAC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 15/50 (30%)
CBM_14 141..185 CDD:279884 10/43 (23%)
ChtBD2 213..261 CDD:214696 10/46 (22%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884
CBM_14 91..142 CDD:279884 16/51 (31%)
CBM_14 160..207 CDD:279884 13/53 (25%)
CBM_14 234..277 CDD:279884 13/59 (22%)
ChtBD2 <296..331 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.