DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and obst-F

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:290 Identity:56/290 - (19%)
Similarity:94/290 - (32%) Gaps:67/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIE 102
            |.||.....|:.|.|..||:.::.|  :....|..|...:.|:....:||...|..||    |:.
  Fly    40 SHICLGRQEGDLVPHPLDCNGYFSC--SRVPTLLYCDQGLQFDENRAICDLPENTNCR----PVA 98

  Fly   103 TPPFDGGNGDGD------------PNNMVTDAATYCSTLVEQQQSSDRI-------VYVGSSSSC 148
            |...:..||..|            |..:..|..:.......::...:.|       .::....:|
  Fly    99 TGTVESANGLADNSELNWWPHKPKPVFVAVDVTSGQPVNPMEKYDPEHIECRHYGAYFLPHPRNC 163

  Fly   149 RKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQC-----------TVGGQEDMPTNGNSG-- 200
            ..|:||.||.....:|.....||....:|.:.::|.|           .|.....:||..:.|  
  Fly   164 GLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVETTMKVPTANSEGAV 228

  Fly   201 -----------------------------FPSGGTAISSDLIHCPAYGQHLYPHMQRCEFFIYCV 236
                                         .|.......::.:.||:..|....|.:.|..:..|:
  Fly   229 TVCYIVGSSEYTTLQQFLTSPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHPEDCSKYYICI 293

  Fly   237 KGHASLQQCPFYYFFDIATKSCQWSRTAQC 266
            .|...|..||...|:|..:..|:..:..:|
  Fly   294 GGMPVLTSCPKGLFWDQKSGFCEMEKNVKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/50 (24%)
CBM_14 141..185 CDD:279884 11/43 (26%)
ChtBD2 213..261 CDD:214696 13/47 (28%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 13/52 (25%)
CBM_14 156..198 CDD:279884 10/41 (24%)
CBM_14 272..321 CDD:279884 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.