DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG10725

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:246 Identity:69/246 - (28%)
Similarity:101/246 - (41%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKC---------- 94
            :|:|.:...||....:|..::||: |..||...||....|::..:.|.....|:|          
  Fly    26 VCSNVVNNLFVPQVGNCSKYFLCM-NEIAVPRECPTDYYFDARDQECVPLMEVECIGSCKNRGLS 89

  Fly    95 -----RNETDPIETPPFDGGN-----GDGDPNNMVTDAATY-----C-STLVEQQQSSDRIVYVG 143
                 |..|..:..  |||..     .||...|.:||...|     | ..|..:..:.|.||::.
  Fly    90 SFCYDRTCTKYVLC--FDGTPVIRQCSDGLQYNALTDRCDYPQYVDCVDNLCSRNNNPDDIVFIP 152

  Fly   144 SSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAI 208
            |.:.|.|||||..|...:|.|:|.|.:|..|..||.|.:..|||   |.:..| ...|......:
  Fly   153 SKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNCTV---ESLQRN-ILPFARAPPRL 213

  Fly   209 SSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQ 259
            :.  |.||:.|.|...|.:|.:.:.||:.|......|.....||...:.|:
  Fly   214 AD--IECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCTPGLVFDAKREECR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/50 (28%)
CBM_14 141..185 CDD:279884 17/43 (40%)
ChtBD2 213..261 CDD:214696 14/47 (30%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 12/38 (32%)
CBM_14 83..134 CDD:279884 11/52 (21%)
CBM_14 150..192 CDD:279884 17/41 (41%)
ChtBD2 216..264 CDD:214696 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.