DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and obst-G

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:95/236 - (40%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPPFDG------------ 108
            |..:|:|.: |:||..:|....|||..:..||...||.|          .|||            
  Fly    46 CKGYYVCAD-GNAVTGTCEKNTLFNPLTLHCDDPDNVDC----------IFDGKDNIVDDTSSSE 99

  Fly   109 GNGDGDPNNMVTD-AATYCSTLVEQQQSSDRI-------VYVGSSSSCRKYYICYYGQAILQECS 165
            .:.|.|.....|| ..|..:|...:..:.|::       |.:..:.||::||:|...:..|:.|.
  Fly   100 SDEDDDEEMAKTDPPVTVKATKKPRPTTLDKMCAGKKDGVMLTKNGSCQEYYVCKAKKPHLRSCP 164

  Fly   166 SQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAYGQHLYPHMQRCE 230
            .:.|::.....|.....|:|:.|.:|:..::|    |:....:.||     .....|..|...|.
  Fly   165 DKQHFSPTRRICMKASEAKCSGGTRENKESDG----PATTGGVCSD-----EKENSLVAHRSDCG 220

  Fly   231 FFIYCVKGHASLQQCPFYYFFDIATKSCQWSRTAQCVRDLN 271
            .|:.|......:..||....|:|||..|.:.:.|:|...||
  Fly   221 KFMLCSNMMFLVMDCPTGLHFNIATSRCDYPKIAKCQTKLN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/35 (34%)
CBM_14 141..185 CDD:279884 10/43 (23%)
ChtBD2 213..261 CDD:214696 12/47 (26%)
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 14/37 (38%)
CBM_14 132..184 CDD:279884 11/51 (22%)
CBM_14 204..256 CDD:279884 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.