DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG5883

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:282 Identity:56/282 - (19%)
Similarity:90/282 - (31%) Gaps:89/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ATAQLTWRPSKPTNSVTIRQSG------------SRICANHLVGEFVEHAEDCHMFYLCVENGDA 68
            :|..:|...|||..|   :..|            |:||.....| ::....:|..:|.|  :.||
  Fly    61 STPGITCSGSKPYYS---KSKGSCQASADTYCDTSKICKGSGTG-YIGDTINCANWYYC--DADA 119

  Fly    69 VL--ASCPPTMLFNSESRLCDSATNVKCRNETD-----PIETPPFDGGNGDGDPNNMVTDAATYC 126
            :|  .:|...|.|:..|:.|..:.:..|..:.:     |:.||..|..|                
  Fly   120 LLGKGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDAN---------------- 168

  Fly   127 STLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQE 191
                                 |.|||.|.....:...|.:.|::|..||.|   .|.:..:....
  Fly   169 ---------------------CHKYYTCSSKSLVENTCENGLYYNVATGTC---VRKKDVICENH 209

  Fly   192 DMPTN--GNSGFPSGGTAISSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHASL-------QQCPF 247
            .:|..  ||.........:|.               |..|..:.||....:.:       |||..
  Fly   210 PLPDEVCGNKKLAVRNKFVSD---------------MATCRGYYYCRDLGSGIPDTDPIYQQCDE 259

  Fly   248 YYFFDIATKSCQWSRTAQCVRD 269
            ..||:...::|....:.:|..|
  Fly   260 NNFFNQERQACMPRESQKCDYD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 13/52 (25%)
CBM_14 141..185 CDD:279884 12/43 (28%)
ChtBD2 213..261 CDD:214696 10/54 (19%)
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 13/53 (25%)
CBM_14 154..204 CDD:279884 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.