DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and Muc68D

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:242 Identity:58/242 - (23%)
Similarity:107/242 - (44%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATN 91
            ||.:....|.....|:|...|.|:...:.|:.:|:|: ||.|:...||..:.|:.:.::|:..:.
  Fly  1300 PTGTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCL-NGKAIAGHCPRNLHFDIKRKVCNFPSL 1363

  Fly    92 VKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYY 156
            |.|     |::..|   .|....|::  |::...|.:|...       .||....||.::|:|..
  Fly  1364 VDC-----PLDEAP---ENVTKKPSD--TESTPDCKSLRNG-------AYVRDPKSCSRFYVCAN 1411

  Fly   157 GQAILQECSSQLHWNAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAYG-- 219
            |:||.::|...||::..:..|:.|...||::   |:...:.:....:.|....:.:.....:|  
  Fly  1412 GRAIPRQCPQGLHFDIKSNFCNYPILVQCSL---EESQADAHGALLAEGVPDCTKVKEDTRFGDV 1473

  Fly   220 -QHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQWSRTAQ 265
             ||        ..:..|:||.|.|..|....:||:.::.|...|.|:
  Fly  1474 KQH--------NKYYVCLKGKAVLHYCSPGNWFDLRSQKCIDQRLAK 1512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/50 (28%)
CBM_14 141..185 CDD:279884 14/43 (33%)
ChtBD2 213..261 CDD:214696 12/50 (24%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 15/52 (29%)
CBM_14 1388..1440 CDD:279884 16/58 (28%)
ChtBD2 1459..1505 CDD:214696 11/53 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.