DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG32302

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:317 Identity:65/317 - (20%)
Similarity:91/317 - (28%) Gaps:122/317 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLLATAQL---TWRPSKPTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCP 74
            ||:..|..   .|....|...|.|   ...:|.|            |.....|:.:.        
  Fly     8 CLILLALALGSAWANDNPCQDVRI---PGFVCMN------------CTTLGYCIRDA-------- 49

  Fly    75 PTMLFNSESRL-CDSATNVKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDR 138
             |..:.:.|.| |.|..|..|                         :|..|:..|...|.|...|
  Fly    50 -TGSWETISMLGCQSEYNFYC-------------------------SDEGTFGCTFQSQCQVPKR 88

  Fly   139 IVYVGSSS-----------SCRKYYICYYGQAI--LQECSSQLHWNAMTGKCDIP-ERAQCTVGG 189
                |..|           .||:|:.| ..|::  .:.||:...::.:||.|.:| |..||.   
  Fly    89 ----GPFSCQQAGLFPDPYDCRRYHEC-SDQSVDTPRICSNGAGYSTLTGTCVLPRESEQCI--- 145

  Fly   190 QEDMPTNGNSGFPSGGTAISSDLIHCPA--YGQHLYPHMQRC-EFFIY----------------- 234
            ||.. |...|| ..||.|..:...:...  ....|||.|.:| |.|::                 
  Fly   146 QEQF-TCSRSG-QVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEGFVFNSYSCVPDTRSMRSIQA 208

  Fly   235 -------------------------CVKGHASLQQCPFYYFFDIATKSCQWSRTAQC 266
                                     ||.|...:..||..:..|....:|...|..||
  Fly   209 MESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 9/51 (18%)
CBM_14 141..185 CDD:279884 14/57 (25%)
ChtBD2 213..261 CDD:214696 14/92 (15%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.