DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and obst-B

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:79/226 - (34%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRL---CDSATNVKCRNETDPIETPPFDGGN 110
            |...::.|..:|.|:: |......|...|:||..|.:   ||...|:.|...: .::||      
  Fly    92 FYPDSKQCDKYYACLD-GVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRS-KLQTP------ 148

  Fly   111 GDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSS--CRKYYICYYGQAILQECSSQLHWNAM 173
                      ..:.:|..         :..|.|....  |.|:|.|..||..:..|.:.|.:|..
  Fly   149 ----------QPSLHCPR---------KNGYFGHEKPGICDKFYFCVDGQFNMITCPAGLVFNPK 194

  Fly   174 TGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAYGQHL------YPHMQRCEFF 232
            ||.|..|::...|....||:       |.          ..||...:.:      |.....|:||
  Fly   195 TGICGWPDQVGVTGCKSEDV-------FD----------FECPKVNESIAVTHPRYADPNDCQFF 242

  Fly   233 IYCVKGHASLQQ-CPFYYFFDIATKSCQWSR 262
            ..||.|....:. |.....||...::|.|:|
  Fly   243 YVCVNGDLPRRNGCKLGQVFDEEKETCDWAR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/45 (27%)
CBM_14 141..185 CDD:279884 15/45 (33%)
ChtBD2 213..261 CDD:214696 13/54 (24%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 13/47 (28%)
CBM_14 156..204 CDD:279884 15/56 (27%)
CBM_14 233..278 CDD:279884 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.