DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and obst-E

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:281 Identity:62/281 - (22%)
Similarity:94/281 - (33%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIVNCLLATAQL----TWRPSKPTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENGDAV 69
            ::::.||..|..    ...|..||.:                |.|.. .:.|..:..| ::|..|
  Fly     4 ILISALLCVAMFGSMALGSPECPTPN----------------GRFAS-GDQCDSYTEC-QDGTPV 50

  Fly    70 LASCPPTMLFNSESRL---CDSATNVKCRNETDPIETPPFDGGNGDGD--------PNNMVTDAA 123
            ...||..:||:..::.   |..|....|:      |.......||..:        ||       
  Fly    51 EKLCPDGLLFHQRTKATGECTYAPYSTCK------ERARLQPANGTEECPRQFGFYPN------- 102

  Fly   124 TYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPERAQCTVG 188
                               |.::.|..|..|.:|.|.|.:|...|.:|..|.:||.|:..     
  Fly   103 -------------------GDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLV----- 143

  Fly   189 GQEDMPTNGNSGF--PSGGTAISS-----DLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCP 246
              |........||  |:..:|..|     |:  .|......|.|.|.|:.:..||.||..|..|.
  Fly   144 --ESCNAEAYLGFNCPAADSADDSAAAAVDV--SPEGELRYYRHPQTCKKYFVCVNGHPRLYNCG 204

  Fly   247 FYYFFDIATKSCQ-WSRTAQC 266
            .|..|:..||.|. :::..:|
  Fly   205 KYLAFNSQTKLCDFYNKVPEC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/53 (23%)
CBM_14 141..185 CDD:279884 14/43 (33%)
ChtBD2 213..261 CDD:214696 16/48 (33%)
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/59 (22%)
CBM_14 95..146 CDD:307643 17/83 (20%)
CBM_14 180..225 CDD:307643 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.