DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:80/238 - (33%) Gaps:60/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GSRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRL---CDSATNVKCRNET 98
            ||..|......:...|.|:|..|:||. ||...|.:|...:||:.:..:   |:....|.|:.. 
  Fly    24 GSPECPEKYGVQAYAHTENCDQFFLCT-NGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGR- 86

  Fly    99 DPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAILQE 163
                         ..||..:.|.|..|...|           |..|......|..|.:|:...|:
  Fly    87 -------------QWDPTPISTPACEYQFGL-----------YAVSKDCSTTYIKCAHGEPHEQD 127

  Fly   164 CSSQLHWNAMTGKCDIPER------AQCTVGGQEDMPTNGNS------GFPSGGTAISSDLIHCP 216
            |.:.|.::.....|:.|::      .:..||.:.....:.||      .||.             
  Fly   128 CDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPR------------- 179

  Fly   217 AYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQ 259
                  :|....|...|.||:||..|..|.....||..|.:|:
  Fly   180 ------FPVAGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/53 (26%)
CBM_14 141..185 CDD:279884 10/49 (20%)
ChtBD2 213..261 CDD:214696 13/47 (28%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 14/47 (30%)
CBM_14 103..147 CDD:279884 11/54 (20%)
ChtBD2 179..218 CDD:214696 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.