DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG34324

DIOPT Version :10

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:97 Identity:27/97 - (27%)
Similarity:39/97 - (40%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 TGKCDIP--ERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLI--HCPAYGQH---LYPHMQRCEF 231
            |..|..|  :.|...|.|.|:.|...|.      .||:..||  | ...||.   ....::.|..
  Fly   169 TTVCTTPKSDNAGPIVDGNEEQPDIDNP------VAIAQVLISRH-DCRGQEDGTFLADVRHCRR 226

  Fly   232 FIYCVKGHASLQQCPFYYFFDIATKSCQWSRT 263
            :..|.:..:..|.||..|:||...|:|:.:.|
  Fly   227 YYVCNRQRSKRQNCPNGYWFDRELKACRLAST 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:426342
CBM_14 141..185 CDD:426342 4/12 (33%)
ChtBD2 213..261 CDD:214696 14/52 (27%)
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.