DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG31077

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:244 Identity:51/244 - (20%)
Similarity:74/244 - (30%) Gaps:88/244 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SGSRICANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNVKCRNETDP 100
            |...||   |.||....:|||..:..|: ||..|...||....|....:||....|..|.:.:..
  Fly   143 SPKEIC---LEGELQVDSEDCAGYLECL-NGGLVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSE 203

  Fly   101 IETPPFDGGNGDG----DPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYICYYGQAIL 161
            ..         ||    ||||                              |..|:.|..|:.|.
  Fly   204 CT---------DGEVRVDPNN------------------------------CAGYFNCENGRLIT 229

  Fly   162 QECSSQLHWNA--------MTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCPAY 218
            :.|.|..::..        :.|.|..|. |:||.|..:..|.|                      
  Fly   230 KTCPSGTYFEPTYKTCTVDLKGVCVEPP-AKCTEGQLKIDPNN---------------------- 271

  Fly   219 GQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSCQWSRTAQCV 267
                      |..::.|:.|....::||...::|...::|.......||
  Fly   272 ----------CAGYLKCIDGEFVEEKCPGGTYYDFKLETCLVDTEGVCV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 16/50 (32%)
CBM_14 141..185 CDD:279884 11/51 (22%)
ChtBD2 213..261 CDD:214696 7/47 (15%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 11/62 (18%)
CBM_14 267..308 CDD:279884 9/72 (13%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.