DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and Mur2B

DIOPT Version :10

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_569927.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:56/159 - (35%) Gaps:50/159 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GEFVEHAEDCHMFYLCVEN-GDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPPFDGGN 110
            |.| .|..||.::|.|.:| ....|.:||...:|:...|.|                .|      
  Fly   153 GRF-PHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKC----------------LP------ 194

  Fly   111 GDGDPNNMVTDAATYCSTLVE------QQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLH 169
            ||..|:..::|:.:|.....|      .::.:.|     |.:.|..||.|.     |||..:.|.
  Fly   195 GDQCPSTEISDSGSYIPQNCELKFPECAEEGTFR-----SPTDCALYYTCR-----LQESGTYLQ 249

  Fly   170 WNAMTGKC------DIPERAQCTVGGQED 192
            ...   ||      |: ||..|....:.|
  Fly   250 TRF---KCPGSNSFDL-ERKLCRPRSEVD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:426342 14/45 (31%)
CBM_14 141..185 CDD:426342 14/49 (29%)
ChtBD2 213..261 CDD:214696
Mur2BNP_569927.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:426342 16/66 (24%)
CBM_14 221..275 CDD:426342 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.