DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and Mur2B

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:56/159 - (35%) Gaps:50/159 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GEFVEHAEDCHMFYLCVEN-GDAVLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPPFDGGN 110
            |.| .|..||.::|.|.:| ....|.:||...:|:...|.|                .|      
  Fly   153 GRF-PHPHDCKVYYRCDKNRTQPWLFACPAGTIFSPVERKC----------------LP------ 194

  Fly   111 GDGDPNNMVTDAATYCSTLVE------QQQSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLH 169
            ||..|:..::|:.:|.....|      .::.:.|     |.:.|..||.|.     |||..:.|.
  Fly   195 GDQCPSTEISDSGSYIPQNCELKFPECAEEGTFR-----SPTDCALYYTCR-----LQESGTYLQ 249

  Fly   170 WNAMTGKC------DIPERAQCTVGGQED 192
            ...   ||      |: ||..|....:.|
  Fly   250 TRF---KCPGSNSFDL-ERKLCRPRSEVD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 14/45 (31%)
CBM_14 141..185 CDD:279884 14/49 (29%)
ChtBD2 213..261 CDD:214696
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696
CBM_14 150..197 CDD:279884 16/66 (24%)
CBM_14 221..275 CDD:279884 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.