DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG33263

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:106/272 - (38%) Gaps:62/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AFYLIVNCLLATA-QLTWRPSKPTNSVTIRQSGSRICANHLVGEFVEHAEDCHMFYLCVENG-DA 68
            :|.|.::|||..| .||          :|.......|||..:..||...|||..:..|  || |:
  Fly     2 SFKLSLHCLLILAGYLT----------SIEAEVFPQCANAPLDTFVMAIEDCASYIYC--NGEDS 54

  Fly    69 VLASCPPTMLFNSESRLCDSATNVKCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCSTLVEQQ 133
            ...|||.:..|:..::.|.......|...:|.::|        :..|:...|.         |:|
  Fly    55 FRDSCPESTYFDDRTQECAFDDEGVCLRNSDSVQT--------EEQPDKQTTG---------EEQ 102

  Fly   134 QSSDRIVYVGSSSSCRKYYICYYGQAILQECSSQLHWNAMTGKCDIPE-RAQCTVGGQEDMPT-- 195
            ...:....|.:..|  .|                    |.||..|... :|..|....|.:|:  
  Fly   103 SGIEETTPVPTPPS--DY--------------------ASTGSADSSTFQADSTTTPTESIPSVT 145

  Fly   196 --NGNSGFPSGGTAISS----DLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIA 254
              ...|..||..:|..|    :..||...|...:||.||||::..|:.|:.::.:||:.|.:|..
  Fly   146 EPPTTSATPSSPSAKPSSPAQERPHCDISGDGDHPHPQRCEYYYRCLSGYLTIVRCPYKYGWDFP 210

  Fly   255 TKSCQWSRTAQC 266
            ||.|:.|..|||
  Fly   211 TKQCKPSSEAQC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 17/51 (33%)
CBM_14 141..185 CDD:279884 8/44 (18%)
ChtBD2 213..261 CDD:214696 18/47 (38%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 17/52 (33%)
CBM_14 171..222 CDD:279884 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I19583
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.