DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and cpg-2

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_498551.3 Gene:cpg-2 / 175991 WormBaseID:WBGene00015102 Length:524 Species:Caenorhabditis elegans


Alignment Length:293 Identity:60/293 - (20%)
Similarity:92/293 - (31%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLCDSATNV-------KCRNET 98
            |.|.|.|.:.  ..:|...:|....|.|.:..||..:::|....:||...||       :...||
 Worm    24 CTNALDGLYA--LGECEPQFLTCSGGIARIMDCPADLIYNEPLLICDWRHNVIGCEGSGESSGET 86

  Fly    99 DPIETPPFDG-----------GNGDGDPNNMVTDAAT-------------YCSTLVEQQQSSDRI 139
            ....:....|           |.|.|:.:...:..|:             .|..|.:...     
 Worm    87 SGEGSGESSGEASGEGSGEASGEGSGEASGEGSGEASGEGSGSGEETVENVCENLEDGAY----- 146

  Fly   140 VYVGSSSSCRKYY-ICYYGQAILQECSSQLHWNAMTGKC---DIPERAQCTVGGQEDMPTNGNSG 200
                ||..|..|| .|....|....|.:.|.::|.:.||   .:.|  :|    :||:.....||
 Worm   147 ----SSGGCTTYYFFCTTNTARFLSCPTPLFYDADSQKCIWKSLVE--EC----KEDLTITDGSG 201

  Fly   201 FPSG-GTAISSDLIH------------------------------CPAYGQHLYPHMQRCEFFIY 234
            ..|| |:..:|....                              |......::|:......|:.
 Worm   202 ETSGEGSGEASGEASGEGSGEASGESSGQGSGEASGEGSGELEPTCEGKADGIHPNGVCSTNFLT 266

  Fly   235 CVKGHASLQQCPFYYFFDIATKSCQWSR-TAQC 266
            |..|.|.:..||....|:.....|.|.| .|:|
 Worm   267 CSGGIARIMDCPASLVFNPTILVCDWPRDVAEC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 13/50 (26%)
CBM_14 141..185 CDD:279884 13/47 (28%)
ChtBD2 213..261 CDD:214696 10/77 (13%)
cpg-2NP_498551.3 CBM_14 24..76 CDD:279884 15/53 (28%)
CBM_14 138..190 CDD:279884 15/62 (24%)
ChtBD2 245..293 CDD:214696 10/47 (21%)
CBM_14 311..359 CDD:279884
CBM_14 403..454 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.