DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and R02F2.4

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:254 Identity:61/254 - (24%)
Similarity:94/254 - (37%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSKPTNSVTIRQSGSRI---CANHLVGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRL 85
            |...|..:||....|:.   |.|  ||:.:.....|...:|...:|:|....||..::::.....
 Worm     5 PCLTTLLLTISTVNSKFVTDCTN--VGDGMYPLGACEPRFLACVSGEARYMDCPEDLVYHKNLEF 67

  Fly    86 CDSATNV-KCRNETDPIETPPFDGGNGDGDPNNMVTDAATYCS--TLVEQ--QQSSDRIVYVGSS 145
            ||...|| :|..|.:..|......|...||......|::...|  .|:|.  :...|.:...|:.
 Worm    68 CDWRHNVFECGEEGEENEFSGDGSGESSGDEEITFGDSSGESSGDELLENVCESLKDGVYSSGTC 132

  Fly   146 SSCRKYYICYYGQAILQECSSQLHWNAMTGKCD----IPERAQCTVGGQEDMPTNGNSGFPSGGT 206
            ||  .|.||..|......||:.|.::....||.    |.|.:|  |.|:                
 Worm   133 SS--SYIICNSGSPRFLSCSTPLIYDPTNKKCSWKGMIDECSQ--VSGE---------------- 177

  Fly   207 AISSDLIHCPAYGQHLYPHMQRCE---FFIYCVKGHASLQQCPFYYFFDIATKSCQWSR 262
                   :|.:.|     ::.:.|   .|..|.:|.|..:.||....|:.|..||.|.:
 Worm   178 -------YCESDG-----NISKSECSNVFFSCSEGIAHRRNCPANLVFNPAISSCDWPK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 12/50 (24%)
CBM_14 141..185 CDD:279884 14/47 (30%)
ChtBD2 213..261 CDD:214696 13/50 (26%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884 12/50 (24%)
ChtBD2 117..165 CDD:214696 13/49 (27%)
CBM_14 185..229 CDD:279884 12/40 (30%)
ChtBD2 240..283 CDD:214696
CBM_14 310..361 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.