DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33986 and CG42728

DIOPT Version :9

Sequence 1:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:118 Identity:32/118 - (27%)
Similarity:48/118 - (40%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CYYGQAILQECSSQLHWNAM--TGKCDIPERAQCTVGGQEDMPTNGNSGFP---------SGGTA 207
            |.|.   |..||.|   |:|  |..........|:    :.:|.:.::..|         :..|.
  Fly    45 CNYS---LINCSGQ---NSMFCTDNTTCNANFTCS----DILPVDNSTALPISTTPNVVTTASTT 99

  Fly   208 IS-SDL-IHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSC 258
            :| ||: ..|.......:.:.|.|.:|.|||.|...::|||..|.||..|.:|
  Fly   100 VSPSDIRRECRQGVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884
CBM_14 141..185 CDD:279884 9/32 (28%)
ChtBD2 213..261 CDD:214696 16/46 (35%)
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.