DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and sh2d5

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001349485.1 Gene:sh2d5 / 541529 ZFINID:ZDB-GENE-050327-67 Length:410 Species:Danio rerio


Alignment Length:386 Identity:80/386 - (20%)
Similarity:126/386 - (32%) Gaps:141/386 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PQPGS---------HPHPHHLRSP----SSEEDNS---------PTEMNNCRRLVDKPPLVKRLT 163
            |||||         ..|....||.    |...|:|         .|::.:.:....|..:..|.:
Zfish     7 PQPGSVWNMGETAGREHGTVTRSAEYIGSFPVDDSCLDDQIQQLHTQLKSLKNCKSKRTVSLRFS 71

  Fly   164 M-GIGLLRGTEDSRPLMHSTCGSSLTSGSGCGSTQTISDG------------------------- 202
            : |:.:....|.:..:.|:.|..||       ||...||.                         
Zfish    72 VKGVKVYDEDETTLLMAHAMCRVSL-------STARPSDAQFAFASHNPGNSDAQLYCHLFRARH 129

  Fly   203 -----YVNEAICEP-DKYVASKFGDSCRQ--------------------SLSALES----ATQRL 237
                 ::|..:|.. ..|...|..:..::                    |:|||.|    .||.|
Zfish   130 ARAAQFLNLLLCRCFQLYFLEKHPEEAQEECSGKKPSRAPSLLNQGFPLSVSALVSFRRAPTQGL 194

  Fly   238 QVELPAASKKYLRETCSANSSPKLFPGHS-------ALRLDNL---------------------- 273
               ||.| |.:.:::....|||:..|..|       |:|...|                      
Zfish   195 ---LPGA-KLFSQQSTEQVSSPEEGPTSSPTIVRKMAIRTKELRSGAYRSFTFTPLKQRHLQDKL 255

  Fly   274 -------------------SLAEQQE-LKGAAWFQAGIPREISLEALSRQSPGAFLVRQSSTKPG 318
                               ||||.:| |..|.|..||:..:.|...|:....||||:.....||.
Zfish   256 SAPQEKEQATAKACMSRAPSLAETEEALAQAVWCWAGVSSDCSSSLLADDVLGAFLLCPHPKKPN 320

  Fly   319 CFALSLRVPPPSPRVAHYLILRTQRGYKIKGFTKEFSSLKALITHHSVMPELLPVPLTLPR 379
            ..:|.:|.   |..:..|.|..::..::::....:|.||.||:.|::...:.|...|:..|
Zfish   321 RGSLIVRF---SSGLVTYAIKNSKGKFRLEKCHTDFESLAALMEHYTEFGDELECSLSCAR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 21/77 (27%)
sh2d5NP_001349485.1 PTB_tensin-related 25..152 CDD:269979 21/133 (16%)
SH2 288..363 CDD:198173 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.