DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and SH2D5

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001096631.1 Gene:SH2D5 / 400745 HGNCID:28819 Length:423 Species:Homo sapiens


Alignment Length:335 Identity:88/335 - (26%)
Similarity:120/335 - (35%) Gaps:65/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RQQPHPHSHSHPHPHPQLQRRPVEQLHLL--HSHHDVQELSGQEHPHPQPGSHPHPHHLRSPSSE 138
            |....|.|....|.....|...|:.||||  .|......|.     ||:..:.|.|         
Human   109 RNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQLAYLLQ-----HPEERAQPEP--------- 159

  Fly   139 EDNSPTEMNNCRRLVDKPPLVKRLTMGIGLLR---GTEDSRPLMHSTCGSSLTSGSG-CGSTQTI 199
                      |.....:.|| |.|:...||:|   |.:.....:|:..........| .||.:.:
Human   160 ----------CPGPTGEVPL-KPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAEGLVGSGKEL 213

  Fly   200 --SDGYVNEA-----ICEP----DKYVASKFGDSCRQSLSALESATQRLQVELPAASKKYLRETC 253
              |:|....|     .|.|    .|.:.||...|     .|....|...|::|.|      ||..
Human   214 PESEGRARHARLGNPYCSPTLVRKKAIRSKVIRS-----GAYRGCTYETQLQLSA------REAF 267

  Fly   254 SA--NSSPKLFPGHSALRLDNLSLAEQQELKGAAWFQAGIPREISLEALSRQSPGAFLVRQSSTK 316
            .|  .:.|:...|||.|.....||.|.      .|..|||.|..:|..|.|...||||:......
Human   268 PAAWEAWPRGPGGHSCLVESEGSLTEN------IWAFAGISRPCALALLRRDVLGAFLLWPELGA 326

  Fly   317 PGCFALSLRVPPPSPRVAHYLILRTQRG-YKIKGFTKEFSSLKALITHHSVMPELLPVPLTLPRP 380
            .|.:.||:|.   ...|..:.:.|...| |.::....||.||:||:.:|:|....|..||.:.|.
Human   327 SGQWCLSVRT---QCGVVPHQVFRNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGRL 388

  Fly   381 PSTRSQRSQG 390
            ..|..::..|
Human   389 NPTYEEQDCG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 26/78 (33%)
SH2D5NP_001096631.1 PTB_tensin-related 23..150 CDD:269979 12/45 (27%)
SH2 296..372 CDD:198173 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..423 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.