DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and CG10479

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001261458.1 Gene:CG10479 / 38674 FlyBaseID:FBgn0035656 Length:379 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:116/254 - (45%) Gaps:59/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 STCGSSLTSGS----------------GC-GSTQTISDGYVNEAICEPDKYVASKFGDSCRQSLS 228
            |:.|||.||.|                .| .|:|..||....|   |.|:       ::...|.:
  Fly   144 SSTGSSSTSSSSPTTPKRSPQKSLLSLNCWQSSQPSSDSNPEE---EQDE-------EAEEDSDA 198

  Fly   229 ALESATQRLQVELPAASKKYLRETCSANSSPKLFPGH-SALRLDNLSLAEQQELKGAAWFQAGIP 292
            .:....|.|....|....|..|      ::| ||..: ||.:..:....|:.||....|:|..|.
  Fly   199 GISDCCQLLAENSPNTMSKRRR------AAP-LFTRYISANQNSDDDEDEEPELLACPWYQPRIT 256

  Fly   293 REISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPRVAHYLILRTQ-RGYKIKGFTKEFSS 356
            .:.:||.|.:.:||:||:|:|:  |..|.|.||: ..:.:|..|.:..|: :.|::||..|:|:|
  Fly   257 AKAALEHLQQATPGSFLLRRST--PRHFELVLRL-ERNNKVKTYPVQSTRNQMYRLKGAKKQFTS 318

  Fly   357 LKALITHHSVMPELLPVPLTLPR------PPSTRSQRSQGAYAGGTGNGGADFEMYGSL 409
            |||||||||||.|.||:.|.:||      |.|.|       ||.       |||...||
  Fly   319 LKALITHHSVMAEQLPLVLDMPRERHVVKPSSVR-------YAD-------DFEPLESL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 32/78 (41%)
CG10479NP_001261458.1 SH2 249..326 CDD:198173 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 1 1.000 - - FOG0007616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.