DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and Tns3

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_011242029.1 Gene:Tns3 / 319939 MGIID:2443012 Length:1553 Species:Mus musculus


Alignment Length:425 Identity:110/425 - (25%)
Similarity:154/425 - (36%) Gaps:123/425 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FISSSSASSS-------SSQTAETTLIETAEKSP--------ASEAAAGTVTTTSPQHFF--HHH 66
            |.||.:.||:       |..:||...:|::.||.        .||:..||       |.|  ...
Mouse  1030 FASSCTVSSNGPGQRRESPPSAERQWVESSPKSTLTLLGNSHPSESPLGT-------HEFCSSGK 1087

  Fly    67 HPPAHP--HPPRQQPHPHSHSHPHPHPQLQRRPV-EQLHL-----------LHSHHDVQELSGQE 117
            ..|..|  .....|...|||......||....|. .|..|           |....|...|....
Mouse  1088 DSPGLPCFQSSELQASFHSHELSMSEPQGALPPAGSQTFLGFNTVTTATSVLPPGEDAGTLLVNS 1152

  Fly   118 H-PHPQPGSH------------PHPHHLRSPSSEEDNSPTEMNNCRRLVDKPPLVKRLTMGIGLL 169
            | ..|.||:.            ||.....||.:...:||...|....|..:|||.::       .
Mouse  1153 HGTSPAPGTPLLTTGAADNGFLPHNFLTVSPGASSHHSPGLQNQNVSLPGQPPLPEK-------K 1210

  Fly   170 RGTEDSRPLMHSTCGSSLTSGSGCGSTQTISDGYVNEAICEPDKYVASKFGDSCRQSLSALESAT 234
            |.:|..|.|...:..||..|....|||.:|....|....|:|.: |||...||....|..:    
Mouse  1211 RASEGDRSLGSVSPSSSGFSSPHSGSTMSIPFPNVLPDFCKPSE-VASPLPDSPNDKLVIV---- 1270

  Fly   235 QRLQVELPAASKKYLRETCSANSSPKLFPGHSALRLDNLSLAEQQELKGAAWFQAGIPREISLEA 299
                        |::::|                              ...|::|.|.||.::..
Mouse  1271 ------------KFVQDT------------------------------SKFWYKADISREQAIAM 1293

  Fly   300 LSRQSPGAFLVRQSSTKPGCFALSLRV--PPPS-------------PRVAHYLILRTQRGYKIKG 349
            |..::||:|:||.|.:..|.:.|:::|  ||||             ..|.|:||..|.:|.::||
Mouse  1294 LKDKAPGSFIVRDSHSFRGAYGLAMKVATPPPSVLHLNKKAGDLSNELVRHFLIECTPKGVRLKG 1358

  Fly   350 FTKE--FSSLKALITHHSVMPELLPVPLTLP-RPP 381
            .:.|  |.||.||:..||:.|..||..|.:| |.|
Mouse  1359 CSNEPYFGSLTALVCQHSITPLALPCKLLIPERDP 1393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 33/94 (35%)
Tns3XP_011242029.1 C1 35..81 CDD:237996
PTP_tensin-3 121..279 CDD:350409
PTEN_C2 286..412 CDD:371036
PHA03307 645..>1077 CDD:223039 13/46 (28%)
PHA03247 <907..1186 CDD:223021 39/162 (24%)
SH2_Tensin_like 1276..1392 CDD:198181 41/145 (28%)
PTB_tensin 1416..1547 CDD:269924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.