DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and Tns4

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_766152.2 Gene:Tns4 / 217169 MGIID:2144377 Length:696 Species:Mus musculus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:126/311 - (40%) Gaps:87/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SGQEHPHPQPGSHP-HPHHLRSPSSEED--NSPTEMNNCRRLVD----KPPLVKRLTMGIGLLRG 171
            |.|..||....|:| ....|.||:|...  :|....:.|.|..|    ..|:     :|:|..:.
Mouse   268 SNQSLPHSSLSSYPSSSRSLGSPASSSSSLHSLDRGSQCGRPSDAQAPSNPI-----LGMGQPQA 327

  Fly   172 TEDSRPL---MHSTCGSSLTSGSGCGSTQTISDGYVNEAICEPDKYVASK---FGDSCRQSLS-- 228
            .: |.|:   ..|:|.:|:|:     |...|....:|.: .||....|.:   ..||.:..::  
Mouse   328 VQ-STPVAKEQASSCPASVTN-----SMADIPIVLINGS-PEPQSPPAQRTPGHQDSVQSRVTSP 385

  Fly   229 -----ALESATQRL-QVELPAA----------SKKYLRETCSANSSPKLFPGHSALRLDNLSLAE 277
                 |::|.::.| .|.|||:          :.|::.:|                         
Mouse   386 SHLCQAIKSPSKTLPDVPLPASPDGPAKDMQPTMKFVMDT------------------------- 425

  Fly   278 QQELKGAAWFQAGIPREISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPR---------- 332
                 ...||:..|.||.::..|..:.||||::|.||:..|.|.|:|:|...|..          
Mouse   426 -----SKYWFKPSITREQAINLLRTEKPGAFVIRDSSSYRGSFGLALKVQETSASAPNRPGEDSS 485

  Fly   333 --VAHYLILRTQRGYKIKGFTKE--FSSLKALITHHSVMPELLPVPLTLPR 379
              :.|:||..:.:|..:||..:|  |.||.:.:..||:|...||..||:|:
Mouse   486 DLIRHFLIESSAKGVHLKGADEEPYFGSLSSFVCQHSIMALALPCKLTIPQ 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 29/91 (32%)
Tns4NP_766152.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..246
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..344 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..416 13/60 (22%)
SH2 425..538 CDD:301589 38/142 (27%)
PTB_tensin 561..691 CDD:269924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45734
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.