DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33993 and shc-2

DIOPT Version :9

Sequence 1:NP_001033991.1 Gene:CG33993 / 3885637 FlyBaseID:FBgn0053993 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_494915.2 Gene:shc-2 / 173860 WormBaseID:WBGene00020867 Length:638 Species:Caenorhabditis elegans


Alignment Length:355 Identity:81/355 - (22%)
Similarity:140/355 - (39%) Gaps:81/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HPQLQRRPVEQLHLLHSHHDVQELSGQEHPHPQPGSHPHPHHLRSPSSEEDNSPT---------- 144
            |.|..:...|..::|.:.:..|.|:.::.......|..||.:..|..:|:.::.|          
 Worm   249 HCQSLKEAEEIENVLRNANQSQVLAAKQPKSAVSTSSMHPTNTASTMTEKRSASTVFLNRFLGKK 313

  Fly   145 ------EMNNCRRLVDKPPLVKRLTMGIGLLRGTEDS-RPLMHSTCGS---------SLTSGSGC 193
                  |...|:|  .:.|:....:..|..|..:..| .|...||...         .|.:...|
 Worm   314 GSQTVDESGQCKR--KRRPVSAVFSSAIHRLSSSTSSVNPKRMSTIEPQAPTREQLLQLQNQMRC 376

  Fly   194 GSTQTISDGYVNEAICEPDKYVASKFGDSCRQSLSALESATQRLQVELPAASKKYLRETCSANSS 258
            .::..:.:        ||      :..|.|..|.:...|:.        |:|......:.|.::|
 Worm   377 AASSPVPE--------EP------RPTDLCAASTTTSTSSV--------ASSSSSNGSSSSTDTS 419

  Fly   259 PKLFPGHSALRLDN--------LSLAEQQELKGAAWFQAGIPREISLEALSRQSPGAFLVRQSST 315
            |......:||..|.        :..|...:|...::|.....::..:..|:.|..|||::|.|.:
 Worm   420 PVPPAPQTALVYDEKLGEWIYPIDQALMTQLDNCSYFVGQPTKDSMVYNLNTQPEGAFVIRYSES 484

  Fly   316 KPGCFALSLRVP---PPSPRVAHYLILRTQRGYKIK--GFTKEFSSLKALITHHSVMPELLPVPL 375
            |..|.|||:|||   .|| .::||||:|.::|:::|  ...|.|.:|:.::|||||:...||..|
 Worm   485 KSKCLALSMRVPCSHNPS-GISHYLIIRNEQGFRLKLSATKKPFPTLQMMLTHHSVLESHLPCTL 548

  Fly   376 -----------------TLPRPPSTRSQRS 388
                             |:.||..|.::.|
 Worm   549 HFVQWQKTNFKQLAAMSTVERPLRTFNRHS 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33993NP_001033991.1 SH2 286..364 CDD:198173 29/82 (35%)
shc-2NP_494915.2 PH-like 152..268 CDD:388408 4/18 (22%)
SH2 454..537 CDD:198173 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 1 1.000 - - FOG0007616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.