DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34012 and CG34021

DIOPT Version :9

Sequence 1:NP_001034001.1 Gene:CG34012 / 3885632 FlyBaseID:FBgn0054012 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001033942.1 Gene:CG34021 / 3885589 FlyBaseID:FBgn0054021 Length:161 Species:Drosophila melanogaster


Alignment Length:101 Identity:43/101 - (42%)
Similarity:62/101 - (61%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KHYSTISRIQKQLRLGNWEYLCQHPEIRAIIRVILHQALNGKPKPENLRKFVADLFNCAQNPLLV 88
            |.|.||..|.:.:|..:|.||.:|||||||||||..:|:  |.||.|:.:|.|:||...::..:|
  Fly    30 KFYETIGNISRNMRKDDWTYLQRHPEIRAIIRVITAEAV--KAKPSNIYQFTANLFGSERDEEMV 92

  Fly    89 PMINTQLKYVKNELKRGRWSQFDAEMLFMESPSTHS 124
            ..||.|||:::.:|:.|.|:..:....|.||..|.|
  Fly    93 EKINKQLKWLEEQLRGGTWNPDEGCAPFPESSETSS 128



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7RE
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019347
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.