DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir62a and Ir87a

DIOPT Version :9

Sequence 1:NP_001033986.1 Gene:Ir62a / 3885628 FlyBaseID:FBgn0053971 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:419 Identity:81/419 - (19%)
Similarity:148/419 - (35%) Gaps:103/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VPNTFWYKNRRTKAWELAGLGGILINQLMMHLNVTMDLFRFEVNGSSLLNMAALTDLIVKGKVEL 276
            :|:|......:.|   |:|:...::..:...|:|::     |:.|.: .|:..|...::.|::|:
  Fly   396 IPDTETQSGGKLK---LSGIEYEMVQTIAERLHVSI-----EMQGEN-SNLYHLFQQLIDGEIEM 451

  Fly   277 -------SPHLYDTLQSNTSVDYSYPTQVAPRC--------FMIPLDNEISRSLYVF-LPFSLTM 325
                   .|.:...:.|:........|....|.        |:...:.:....:.:| :..||.:
  Fly   452 IVGGIDEDPSISQFVSSSIPYHQDELTWCVARAKRRHGFFNFVATFNADAGFLIGIFVVTCSLVV 516

  Fly   326 WLCLLFVLLVVHFVYVRRLIPDGHFWAILGVPGAGQVRYGNRKPVRRFS-TFLILFGI-FILG-- 386
            ||...     |....:|.|  :|:|...|.|.|   :......|.:.|. |...||.: |::|  
  Fly   517 WLAQR-----VSGFQLRNL--NGYFPTCLRVLG---ILLNQAIPAQDFPITLRQLFALSFLMGFF 571

  Fly   387 --QTYSTKLTSSLTVTLIRRPDNSLEELFLLPYRILVLPTD----------------------VY 427
              .||.:.|.|:||........::|:|::  ..::.|:.|.                      .|
  Fly   572 FSNTYQSFLISTLTTPRSSYQIHTLQEIY--SNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCY 634

  Fly   428 AIVDSLGHAEQFSTKFSCTDAENFSQKRISMHPEYIYPISTIRWRFFDMQQRFLRKKRFYFSKIC 492
            .:||.|..|.|         .|:.:......|..|...|...|...||      |::..|...:.
  Fly   635 NLVDCLNDAAQ---------NEHIAVAVSRQHSFYNPRIQRDRLYCFD------RRESLYVYLVT 684

  Fly   493 HGSFPYQYQLRVDSHLKDALHRFLLHVQQAGLHDLWLDTCYRKAHRMGYLKDFSTLAELEEKL-R 556
            . ..|.:|      ||...::..:.|:.::|             |...:.:|......:.|:: |
  Fly   685 M-LLPKKY------HLLHQINPVIQHIIESG-------------HMQKWARDLDMRRMIHEEITR 729

  Fly   557 LRPLALNLLVPAFSLFLCGMLGSGIAFLV 585
            :|......|  .|..|...:..||...||
  Fly   730 VREDPFKAL--TFDQFRGAIAFSGGLLLV 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir62aNP_001033986.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.