DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir62a and Ir11a

DIOPT Version :9

Sequence 1:NP_001033986.1 Gene:Ir62a / 3885628 FlyBaseID:FBgn0053971 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:380 Identity:72/380 - (18%)
Similarity:141/380 - (37%) Gaps:99/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PHHVF------PPANRKNFRGYRMRLPVQQDVPNTFWYKNRRTKAWELAGLGGILINQLMMHLNV 245
            ||.::      |||:       .:.:|.:                 :|||:...|:..|...|..
  Fly   250 PHLIYKRHKDPPPAS-------NVSIPAE-----------------DLAGIDWDLLQLLAKALKF 290

  Fly   246 TMDLFR----FEVNGSSLLNMAALTDLIVKGKVEL-------SPHLYDTLQSNTSVDYSYPTQVA 299
            .:.|:.    .::.|..  |::.....:..|.|.:       |.........:|....|....|.
  Fly   291 RIQLYMPQEPSQIFGEG--NVSGCFRQLADGTVSIAIGGLSGSDKRRSLFSKSTVYHQSNFVMVV 353

  Fly   300 PRCFMIPLDNEISRSLYVFLPFSLTMWLCLLFVLL--VVHFVYVRRLIPDGH-----FWAILG-- 355
            .|      |..:.|...:.|||...:|..::.:||  |:...::|..:...|     ...|:|  
  Fly   354 RR------DRYLGRLGPLILPFRGKLWGVIIVILLLAVLSTCWLRSRLGLSHPIEDLLTVIVGNP 412

  Fly   356 -----VPGAGQVRYGNRKPVRRFSTFLILFGIFILGQTYSTKLTSSLTVTLIRRPDNSLEELFLL 415
                 :||.|.:||       ..:::::|  ..:|...|..:|...|.::. .||         |
  Fly   413 IPDHRLPGKGFLRY-------LLASWMLL--TLVLRCAYQARLFDVLRLSR-HRP---------L 458

  Fly   416 PYRILVLPTDVYAIVDSLGHAEQFSTKFSCTDAENFSQK--RI--SMHPEYIYPISTIR----WR 472
            |..:..|..|.|.:|.: |:.:.:..:.:|....:||.:  |:  :...|.:..|:.|.    |.
  Fly   459 PKDLSGLIKDNYTMVAN-GYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLAYWN 522

  Fly   473 FFD---MQQRFLRKKRFYFSKICHGSFPYQYQLR--VDSHLKDALHR-FLLHVQQ 521
            ...   .:..|:|:..:.:..:.:  ||.::.||  :|..:|..|.. .:.|:::
  Fly   523 HKHPNISRLTFVRQPIYMYHLVIY--FPRRFFLRPAIDRKIKQLLSAGVMAHIER 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir62aNP_001033986.1 None
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 8/57 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.