DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and GLYATL1

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_542392.2 Gene:GLYATL1 / 92292 HGNCID:30519 Length:333 Species:Homo sapiens


Alignment Length:200 Identity:45/200 - (22%)
Similarity:83/200 - (41%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IKGTPEDLGKLLN----SLKLKVFH---LICGYEERFKPLVEA-----YWLNLGQDLINLEHQGA 130
            |:|..|.||:.:.    |..:||.|   |:...|:..|....:     .|...|.          
Human   134 IQGLQESLGEGIRVATFSKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGH---------- 188

  Fly   131 IVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAY-RSADSITMIRGFMENNLAVGVFDN 194
                 |..|..|..|:.    |.|.:..:::.||:.:|.. ::..|:..|:..:|:..|..:...
Human   189 -----PDDEFESETPNF----KYAQLDVSYSGLVNDNWKRGKNERSLHYIKRCIEDLPAACMLGP 244

  Fly   195 QGEPLAWCLRSPHGSLSNLHVLSSHRRMG-LGSLAVRFMANEIKLKGSEVLATVVPENEGSQKMF 258
            :|.|::|....|...:...:.:..:||.| :..:.||:| ..::.|......:|:.|||.|::..
Human   245 EGVPVSWVTMDPSCEVGMAYSMEKYRRTGNMARVMVRYM-KYLRQKNIPFYISVLEENEDSRRFV 308

  Fly   259 EKLGF 263
            .:.||
Human   309 GQFGF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 24/110 (22%)
NAT_SF 189..272 CDD:302625 17/75 (23%)
GLYATL1NP_542392.2 Gly_acyl_tr_N 51..238 CDD:283638 26/122 (21%)
Gly_acyl_tr_C 239..327 CDD:117021 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.