DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and si:ch73-106k19.2

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_009304583.2 Gene:si:ch73-106k19.2 / 799646 ZFINID:ZDB-GENE-131121-349 Length:284 Species:Danio rerio


Alignment Length:264 Identity:64/264 - (24%)
Similarity:103/264 - (39%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NYIPLSTTESIKIYTTDTDWRTHGSYILI-----HYLENKAYIY--MNTIKGTPEDLGKLLNSLK 93
            |:.|    ||||:|         |....|     |.||..|.::  ...|...|:..|.......
Zfish    18 NFFP----ESIKVY---------GCIFNINRGKPHNLEVIADLWPEFTVIICKPKVQGVKNREGD 69

  Fly    94 LKVFHLICGYEERFKPLV--------EAYWLNLGQDLINLEHQGAIVYHLPSTEIPSWKPSL--- 147
            ..::.:....::..|..:        :|:.|..|   :::.|.||:........|||....:   
Zfish    70 FNIYSIYSKSKDSLKSFLDTPGVINKDAFTLLAG---VDIRHLGAVQEFADQHGIPSKVQGVMNV 131

  Fly   148 --------------STSCKVAYITSNHAELVDKHWAY-RSADSITMIRGFMENNLAVGVF-DNQG 196
                          ......|.:::.||.||:..|.| ..:.|...:..::.:|.::.|. :.|.
Zfish   132 LVLQDQQQLQFKDRHAGLSFAPLSTAHAHLVNSTWKYGGDSSSYNSVLNYISHNPSLCVIEEGQT 196

  Fly   197 EPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENEGSQKMFEKL 261
            ||::|.|..||.:|..|:.|..||..|...|.|..|:..:..:|..|...|..||:.|.|:|..|
Zfish   197 EPVSWLLVYPHAALGLLYTLPQHRCKGYARLLVSIMSKNLLEQGHPVYCFVEEENKPSYKLFTSL 261

  Fly   262 GFNN 265
            ||.|
Zfish   262 GFQN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 35/110 (32%)
NAT_SF 189..272 CDD:302625 29/78 (37%)
si:ch73-106k19.2XP_009304583.2 Gly_acyl_tr_N 9..187 CDD:310541 35/184 (19%)
NAT_SF 187..264 CDD:327402 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.