DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Glyatl3

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001138534.1 Gene:Glyatl3 / 688536 RGDID:1587643 Length:290 Species:Rattus norvegicus


Alignment Length:300 Identity:56/300 - (18%)
Similarity:113/300 - (37%) Gaps:69/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LYANDRTNLTGFDLIEYFL-NYIPLSTTESIKIYTTDTDWRTHGSY----ILIHYLENKAYIYMN 76
            |..|..|.|.   |:|..| ::.|    ||:|:|....:......:    :|..:.:.||.|...
  Rat     2 LVLNCSTKLL---LLENMLKSHFP----ESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAIITRR 59

  Fly    77 TIKGTPEDLGKLLNSL-----------KLKVFHLICGYEERF-------------KPLVEAYWLN 117
            ..:...::|....|:.           :|...|.:..:::.|             |.:..|..|:
  Rat    60 QREAVTDNLDHYTNAYAVFYKDVRAYQQLLEEHDVINWDQIFQIQGLQSELYTASKAIASAKLLD 124

  Fly   118 LGQDLINLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGF 182
            |...|.:.:    .|:..|.:..|.......::.::.|::...|:|:::.|:          ||.
  Rat   125 LEIKLASFK----AVHFSPVSSEPDHSFLTGSTPRLTYLSVTDADLLNRTWS----------RGG 175

  Fly   183 MENNL-----------AVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEI 236
            .:..|           :|.|.|.:|.|::|.:.....::.:.:.|..|||.|...|....:|.::
  Rat   176 NQQCLRYLAKLIACFPSVCVRDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALTLARKL 240

  Fly   237 KLKGSEVLATVVPENEGSQKMFEKLGFNNINKLYWAVIPC 276
            :.:|......|:.:|..|        .|.:..::...:||
  Rat   241 QSRGFPSQGNVLDDNMAS--------INLLKSVHAEFLPC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 24/119 (20%)
NAT_SF 189..272 CDD:302625 18/82 (22%)
Glyatl3NP_001138534.1 Gly_acyl_tr_N 1..192 CDD:399190 36/210 (17%)
NAT_SF 193..281 CDD:418431 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.