DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Keg1

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_083826.1 Gene:Keg1 / 64697 MGIID:1928492 Length:295 Species:Mus musculus


Alignment Length:302 Identity:60/302 - (19%)
Similarity:106/302 - (35%) Gaps:89/302 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTD-------------TDWR 56
            |::|  ||:...:....:......||..|...|:         :|:.|             .:|:
Mouse    45 LVDK--WPDFNTVVIRPQEEDMTDDLDHYNNTYL---------VYSKDPKHCQEFLGSSEVINWK 98

  Fly    57 THGSYILIHYLENKAYIYMNTIKGTPEDLGKLLNSL------KLK----VFHLICGYEERFKP-L 110
            .|        |:         |:.:..||||::.||      |:|    ..:::|...::..| |
Mouse    99 QH--------LQ---------IQSSQSDLGKVIESLGATNLGKVKHKQCFLYMVCQTAKKLAPSL 146

  Fly   111 VEAYWLNLGQD-LINLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSAD 174
            ::|..|.:.:: |..|:.|                     ..|.|.:...||.||:..|.:...:
Mouse   147 MDAKNLVVSRNKLTPLDQQ---------------------LFKFASLDVTHAALVNSLWHFGGNE 190

  Fly   175 SITMIRGFMENNL----AVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANE 235
            .   .:.|:|..:    :..:...:|.|::|.|....|.|.....|..:||..|...........
Mouse   191 K---SQKFIERCIFTFPSFCIMGPEGTPVSWTLMDHTGELRMGGTLPKYRRQSLIYHVASQQIQT 252

  Fly   236 IKLKGSEVLATVVPENEGSQKMFEKLGFNNINKLYWAVIPCT 277
            ::..|..:.|.|...|...|:|...||        ..::|||
Mouse   253 LEKLGFPMYAHVDKANFTVQRMVGLLG--------QILLPCT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 25/112 (22%)
NAT_SF 189..272 CDD:302625 18/82 (22%)
Keg1NP_083826.1 Gly_acyl_tr_N 10..205 CDD:283638 39/211 (18%)
Gly_acyl_tr_C 206..294 CDD:117021 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.