DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and si:dkey-76k16.6

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001314704.1 Gene:si:dkey-76k16.6 / 566817 ZFINID:ZDB-GENE-090312-171 Length:295 Species:Danio rerio


Alignment Length:263 Identity:61/263 - (23%)
Similarity:103/263 - (39%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPILIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDTDWRTHGSYILIHY 66
            :|:::...||||.|.|.........|                :|.|..|.              :
Zfish    62 DPVIVLVDQWPEFRVLLIKPEYREKG----------------DSFKDMTV--------------F 96

  Fly    67 LENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLIC-GYEERFKPLVEAYWLNLGQDLINLEHQGA 130
            .:|..|:         .||....:.:..|.|  || ..|.:.:.::|....|.|..:    .:.|
Zfish    97 SKNDDYL---------RDLLAQRDVIDWKKF--ICLAAELKHEKIMEVVAENRGVPV----KKEA 146

  Fly   131 IVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVFDNQ 195
            :.:.|...::.......|.|.|::.:..:|.|||:.:|.:...||..||:..:.|..:..|.|:.
Zfish   147 VCHMLVLQDLSKLPAFDSLSLKISSLNESHLELVNSNWKFGCEDSKVMIKNMIANFPSCCVLDSD 211

  Fly   196 GEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENEGSQKMFEK 260
            .:|:||.|.....:|..|:.|..||..|.....|..|:.::..:|..|......||:.|.::|..
Zfish   212 DQPVAWLLTYVSCALGILYTLPEHRGKGYAKALVTVMSKKLHSQGCPVYCFTEEENQLSYRLFTS 276

  Fly   261 LGF 263
            |||
Zfish   277 LGF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 33/109 (30%)
NAT_SF 189..272 CDD:302625 23/75 (31%)
si:dkey-76k16.6NP_001314704.1 Gly_acyl_tr_N 30..204 CDD:283638 38/186 (20%)
NAT_SF 205..283 CDD:302625 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41491
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.