DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Glyatl3

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001138532.1 Gene:Glyatl3 / 435528 MGIID:3647683 Length:290 Species:Mus musculus


Alignment Length:305 Identity:58/305 - (19%)
Similarity:116/305 - (38%) Gaps:86/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSQWPELRDLYAN----DRTNLTGFDLIEYFLNYIPLSTTESIKIYTT------DTDWRTH--GS 60
            ||.:||...:|..    :|.|        .|...:.|.:..:.|:..|      :||...|  .:
Mouse    18 KSHFPESLKVYGAVMNINRGN--------PFQKEVVLDSWPNFKVIITRREREAETDNLDHYTNA 74

  Fly    61 YILIHYLENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICGYEERF-------------KPLVE 112
            | .:.|.:.:||             .:||..      |.:..:::.|             |.:.:
Mouse    75 Y-AVFYKDIRAY-------------QQLLEE------HDVINWDQVFQIQGLQSELYAASKAVAK 119

  Fly   113 AYWLNLGQDLINLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSIT 177
            |..|:|..:|.:.:    .|:..|.:.:|........:.::.|::.:.|:|:::.|:        
Mouse   120 ARLLDLDINLASFK----AVHFSPVSSVPDHSFLTGPTPRLTYLSVSDADLLNRTWS-------- 172

  Fly   178 MIRG-------FMENNLA----VGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRF 231
              ||       ::.|.:|    |.|.|.:|.|::|.:.....::.:.:.|..|||.|...|....
Mouse   173 --RGGNQQCLRYLANLIACFPSVCVRDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRLVALT 235

  Fly   232 MANEIKLKGSEVLATVVPENEGSQKMFEKLGFNNINKLYWAVIPC 276
            :|.:::.:|......|:.:|..|        .|.:..:....:||
Mouse   236 LARKLQSRGFPSQGNVLDDNLAS--------INLLKSVQAEFLPC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 25/119 (21%)
NAT_SF 189..272 CDD:302625 18/82 (22%)
Glyatl3NP_001138532.1 Gly_acyl_tr_N 10..192 CDD:368708 38/215 (18%)
NAT_SF 193..281 CDD:388411 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.