DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and GLYATL3

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001010904.1 Gene:GLYATL3 / 389396 HGNCID:21349 Length:288 Species:Homo sapiens


Alignment Length:286 Identity:51/286 - (17%)
Similarity:100/286 - (34%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WPELRDLYANDRTNLTGFDLIEYFLNYIPL---------STTESIKIYTTDTDWRTHGSYILIHY 66
            ||:.:.:... |......|.::::.|...:         ...|...::..|..::..|       
Human    49 WPDFKAVITR-RQREAETDNLDHYTNAYAVFYKDVRAYRQLLEECDVFNWDQVFQIQG------- 105

  Fly    67 LENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICGYEERFKPLVEAYWLNLGQDLINLEHQGAI 131
            |:::.|.....:..:     |.|| :||..|..:     .|.|                      
Human   106 LQSELYDVSKAVANS-----KQLN-IKLTSFKAV-----HFSP---------------------- 137

  Fly   132 VYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGFMENNL--------- 187
            |..||.|....     ..|.::.|::..:|:|:::.|:          ||..|..|         
Human   138 VSSLPDTSFLK-----GPSPRLTYLSVANADLLNRTWS----------RGGNEQCLRYIANLISC 187

  Fly   188 --AVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPE 250
              :|.|.|.:|.|::|.:.....::.:.:.|..|||.|...|....:|.:::.:|......|:.:
Human   188 FPSVCVRDEKGNPVSWSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQSRGFPSQGNVLDD 252

  Fly   251 NEGSQKMFEKLGFNNINKLYWAVIPC 276
            |..|..:        :..|:...:||
Human   253 NTASISL--------LKSLHAEFLPC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 25/119 (21%)
NAT_SF 189..272 CDD:302625 18/82 (22%)
GLYATL3NP_001010904.1 Gly_acyl_tr_N 10..190 CDD:283638 31/196 (16%)
NAT_SF 191..279 CDD:302625 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.