DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and CG5783

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_609869.1 Gene:CG5783 / 35088 FlyBaseID:FBgn0032670 Length:287 Species:Drosophila melanogaster


Alignment Length:273 Identity:74/273 - (27%)
Similarity:128/273 - (46%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSQWPE-LRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDT-DWRTHGSYILIHYLENK 70
            |..||: .::.|..|       :.:| ||...|  ...:||:||.|. ..|..|.::::    ::
  Fly    21 KQNWPKYCQEYYCLD-------NFVE-FLKKQP--HMRNIKMYTLDAKQARDEGLFVIV----DR 71

  Fly    71 AYIYMNTIKGTPEDLGKLLNSLK----LKVFHLICGYEERFKPLVEAYWLNL-GQDLINLEHQGA 130
            ..:::..:..|...:||.|:.|.    ||...:...:......|||:..||| .:|..||     
  Fly    72 YQLFVGCLNNTNGLVGKALDLLDWSSGLKCSSIPSRHIGALDSLVESKKLNLVYRDCTNL----- 131

  Fly   131 IVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGFMENNLAVGVF--D 193
              :.:.:.:....|....:...:..::...|.||:..|......|:..:...:...::||::  |
  Fly   132 --FFMKANDALKLKVEPPSGFVLKSLSVADAPLVNAEWPNHHEGSLFFVERQIRLCVSVGLYQED 194

  Fly   194 NQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVVPENEGSQKMF 258
            .| |.:|||:|...|.|..|.|..:|:|.|.||:..|.:|..:.::|.:|:|.|.|.|:.|.:||
  Fly   195 TQ-ELVAWCIRLQGGYLGALQVKDTHKRRGFGSVVTREIAYRLAVQGHDVMALVGPSNKPSSEMF 258

  Fly   259 EKLGFNNINKLYW 271
            .||||..|::.||
  Fly   259 SKLGFQVIDQCYW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 37/110 (34%)
NAT_SF 189..272 CDD:302625 36/85 (42%)
CG5783NP_609869.1 Gly_acyl_tr_N <91..183 CDD:283638 18/98 (18%)
FR47 187..272 CDD:117022 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449948
Domainoid 1 1.000 55 1.000 Domainoid score I11093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112855at50557
OrthoFinder 1 1.000 - - FOG0003854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.