DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and CG14615

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster


Alignment Length:302 Identity:68/302 - (22%)
Similarity:120/302 - (39%) Gaps:70/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IEKSQWPELRDLYANDRTNLTGFDLIEYFLNY-------------IPLSTTESIKI----YT-TD 52
            :..|:..||.||| ..:..:..|   .|.|.|             ||.:....|.:    || ..
  Fly    13 LSDSEVDELLDLY-KVKFGIRNF---HYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRR 73

  Fly    53 TDWRTHGSYILIH--YLENKAYIYMNTIKGTPE-------------DLGKLLNSLKLKVFHLICG 102
            .::||.|:|:.:|  .:::.::..... .|..|             ..|.||.::.|       |
  Fly    74 GNFRTWGTYVSLHRDIVQSVSFFSWQP-DGAAELWECLEQTQLIEWTQGALLTNVDL-------G 130

  Fly   103 YEERFKPLVEAYWLNLGQDLIN--------LEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSN 159
            :..|.|.|.    ::.|...|.        |.|:.|....:|  ::||       ..::..:.:.
  Fly   131 FCNRVKELA----VSRGVTAIQPRQCFGMVLSHEDAFCAKVP--DLPS-------EFEIRRLRAE 182

  Fly   160 HAELVDKHWAYRSADSITMIRGFMENNLAVGVF-DNQGEPLAWCLRSPHGSLSNLHVLSSHRRMG 223
            .|.:|...|..:...|:|.::..:..|.::|:. .:.||.:||..::....|..|.||....|.|
  Fly   183 DAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRG 247

  Fly   224 LGSLAVRFMANEIKLKGSEVLAT--VVPENEGSQKMFEKLGF 263
            ||.|....|:.|| .:|.|:..|  :|..|..|:.:.:::|:
  Fly   248 LGGLLAAAMSREI-ARGEEITLTAWIVATNWRSEALLKRIGY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 30/112 (27%)
NAT_SF 189..272 CDD:302625 24/78 (31%)
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 31/126 (25%)
FR47 211..297 CDD:117022 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.