DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Glyat

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:311 Identity:64/311 - (20%)
Similarity:100/311 - (32%) Gaps:101/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDTD-------------WR 56
            |::|  ||:...:....:......||..|         |.:.:||:.|.:             |:
  Rat    46 LVDK--WPDFNTVVVRPQEQEMKDDLDFY---------TNTYQIYSKDPENCQEFLGSSEVINWK 99

  Fly    57 TH--------------GSYILIHYL-----ENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICG 102
            .|              .:...||.|     ||..|:...|::       ||..|| |...:|..|
  Rat   100 QHLQIQSSQSHLNKAIQNLASIHSLQVKHSENILYVVSETVR-------KLFPSL-LDTKNLSPG 156

  Fly   103 YEERFKPLVEAYWLNLGQDLINLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKH 167
               ..||           ..||.|     ::.|.|.::                  .||.||:|.
  Rat   157 ---SGKP-----------KAINQE-----MFKLSSLDV------------------THAALVNKF 184

  Fly   168 WAYRSAD-SITMIRGFMENNLAVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRF 231
            |.:...: |...|...::|..:..|...:|.|.:|.|....|.:.....:..:|..||.|..:..
  Rat   185 WLFGGNERSQRFIERCIKNFPSSCVLGPEGTPASWTLMDQTGEMRMGGTVPQYRAQGLVSFVIYS 249

  Fly   232 MANEIKLKGSEVLATVVPENEGSQKMFEKL-------GFNNINKLYWAVIP 275
            ....:|.:|..|.:.....|...|||...|       .:|.     |..:|
  Rat   250 QDQIMKKRGFPVYSHTDKSNTVMQKMSYSLQHLPMPCAWNQ-----WICVP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 27/116 (23%)
NAT_SF 189..272 CDD:302625 19/89 (21%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 37/191 (19%)
Gly_acyl_tr_C 207..295 CDD:117021 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.