DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Gm4952

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001013784.2 Gene:Gm4952 / 240549 MGIID:3643569 Length:296 Species:Mus musculus


Alignment Length:301 Identity:57/301 - (18%)
Similarity:107/301 - (35%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDTDWRTHGSYILIHYLEN 69
            |::|  ||:...:....|....|.||.::         |.:.:||:.|..          |.|| 
Mouse    45 LVDK--WPDFNTVVVRPREQEMGDDLDQH---------TNTYQIYSKDPK----------HCLE- 87

  Fly    70 KAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICGYEERFKPLVEAYWLNLGQDLINL--------E 126
                    ..|||:                :..:::..:  :::...||.:.:::|        :
Mouse    88 --------FLGTPD----------------VINWKQHLQ--IQSSQSNLNEAIMDLAAGKMVKVK 126

  Fly   127 HQGAIVYHLPSTE---IP------------SWKPSL--STSCKVAYITSNHAELVDKHWAY---- 170
            ....|:|.:|.|.   :|            |.:|..  ....|::.:...||.||||.|.:    
Mouse   127 RTQCILYMMPETAKKLVPSLLEDKEYLDHQSGRPRAIDQEMFKLSTLDVTHAPLVDKFWQFGGNE 191

  Fly   171 RSADSITMIRGFMENNLAVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANE 235
            ||...|........::..:|   .:|.|::|.|....|.:.....:..:|..||.|..:......
Mouse   192 RSQRFIGRCIQIFPSSCLLG---PEGTPVSWALMDQTGEIRMAGTVPDYRAQGLISHIIYAQTLA 253

  Fly   236 IKLKGSEVLATVVPENEGSQKMFEKLGFNNINKLYWAVIPC 276
            :..:|    ..|....|.:.|:.:|:.    :.|:...:||
Mouse   254 MDKRG----YPVYNHTEQTNKVIQKMS----HTLHHVPMPC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 25/112 (22%)
NAT_SF 189..272 CDD:302625 16/82 (20%)
Gm4952NP_001013784.2 Gly_acyl_tr_N 10..206 CDD:283638 39/208 (19%)
NAT_SF 207..295 CDD:302625 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5500
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.