DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and Glyatl2

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_599157.2 Gene:Glyatl2 / 171179 RGDID:621231 Length:295 Species:Rattus norvegicus


Alignment Length:289 Identity:60/289 - (20%)
Similarity:100/289 - (34%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTD-------------TDWRTHGSY 61
            :||:...:....:......||..|...|:         ||:.|             .:|:.|   
  Rat    48 KWPDFNTVVIRPQEQDMTDDLDHYNNTYL---------IYSKDPKHCQEFLGSSDVINWKQH--- 100

  Fly    62 ILIHYLENKAYIYMNTIKGTPEDLGKLLNSLKL----KVFHLICGYEERFKPLVEAYWLNLGQDL 122
                 |:         |:.:..||||::.:|..    ||.|..|     |..:|......|...|
  Rat   101 -----LQ---------IQSSQADLGKVIENLGATNLGKVKHKQC-----FLYMVSHTAKKLTPSL 146

  Fly   123 INLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSADSITMIRGFMENNL 187
            ::.:|.      :.|:|.|:  |......|.|.:...||.||:..|.:...:.   .:.|:|..:
  Rat   147 VDAKHL------VVSSEKPT--PFDHQLFKFARLDVKHAALVNSIWYFGGNEK---SQKFIERCI 200

  Fly   188 ----AVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSEVLATVV 248
                :|.:...:|.|::|.|....|.|.....|..:|...|.........:.::..|..:...|.
  Rat   201 FTFPSVCIMGPEGTPVSWALMDHTGELRMAGTLPKYRHQNLIYHVAFHQVHTLEKLGFPMYLHVD 265

  Fly   249 PENEGSQKMFEKLGFNNINKLYWAVIPCT 277
            ..|...|:|...||.        ..:|||
  Rat   266 KVNLTIQRMSAVLGH--------VPMPCT 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 24/112 (21%)
NAT_SF 189..272 CDD:302625 17/82 (21%)
Glyatl2NP_599157.2 Gly_acyl_tr_N 1..205 CDD:399190 40/198 (20%)
Gly_acyl_tr_C 206..294 CDD:117021 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.