DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and GLYAT

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_964011.2 Gene:GLYAT / 10249 HGNCID:13734 Length:296 Species:Homo sapiens


Alignment Length:295 Identity:59/295 - (20%)
Similarity:102/295 - (34%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QWPELRDLYA----NDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTD-------------TDWRT 57
            :||:...:..    .|.|:    ||..|         |.:.:||:.|             .:|:.
Human    49 KWPDFNTVVVCPQEQDMTD----DLDHY---------TNTYQIYSKDPQNCQEFLGSPELINWKQ 100

  Fly    58 H-----GSYILIHYLENKAYIYMNTIKGTPEDLGKLLNSLKLKVFHLICGYEERFKP-LVEAYWL 116
            |     ....|...::|.|.|....:|.|.            ::.::.....:...| |:::..|
Human   101 HLQIQSSQPSLNEAIQNLAAIKSFKVKQTQ------------RILYMAAETAKELTPFLLKSKIL 153

  Fly   117 --NLGQ-DLINLEHQGAIVYHLPSTEIPSWKPSLSTSCKVAYITSNHAELVDKHWAYRSAD-SIT 177
              |.|: ..||.|     ::.|.|.::                  .||.||:|.|.:...: |..
Human   154 SPNGGKPKAINQE-----MFKLSSMDV------------------THAHLVNKFWHFGGNERSQR 195

  Fly   178 MIRGFMENNLAVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGSE 242
            .|...::......:...:|.|:.|.|....|.:.....|..:|..||.:..:...|.::...|..
Human   196 FIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFP 260

  Fly   243 VLATVVPENEGSQKMFEKLGFNNINKLY--WAVIP 275
            |.:.|...||..|||...|....|.:.:  |..:|
Human   261 VYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 27/109 (25%)
NAT_SF 189..272 CDD:302625 20/84 (24%)
GLYATNP_964011.2 Gly_acyl_tr_N 11..206 CDD:310541 37/204 (18%)
Gly_acyl_tr_C 207..295 CDD:117021 21/87 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.