DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glyat and GLYATL1B

DIOPT Version :9

Sequence 1:NP_001033883.2 Gene:Glyat / 3885627 FlyBaseID:FBgn0054010 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001342495.1 Gene:GLYATL1B / 100287520 HGNCID:37865 Length:302 Species:Homo sapiens


Alignment Length:282 Identity:54/282 - (19%)
Similarity:102/282 - (36%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILIEKSQWPELRDLYANDRTNLTGFDLIEYFLNYIPLSTTESIKIYTTDTDWRTHGSYILIHYLE 68
            :|::  .|||.:.:....:......|:..|         |...::::.|.....       ..|:
Human    44 VLVD--SWPEYQMVIIRPQKQEMTDDMDSY---------TNVYRVFSKDPQKSQ-------EVLK 90

  Fly    69 NKAYIYMN---TIKGTPEDLGK------LLNSLKLKVFHLICGYEERFKPLVEAYWLNLGQDLIN 124
            |...|...   .|:|..|.||:      ..||:|:          |..:.|     |.:.:|::.
Human    91 NSEIINWKQKLQIQGFQESLGEGIRAAAFSNSVKV----------EHSRAL-----LFVTEDILK 140

  Fly   125 LEHQGAIVYHLPSTEIPSWK---------PSLSTSCKVAYITSNHAELVDKHWAY----RSADSI 176
            |       |....:::.||.         .|.:.:.|.|.:..:::.||:.:|..    ||...|
Human   141 L-------YATNKSKLGSWAETGHPDDELESETPNFKYAQLNVSYSGLVNDNWKLGMNKRSLRYI 198

  Fly   177 TMIRGFMENNLAVGVFDNQGEPLAWCLRSPHGSLSNLHVLSSHRRMGLGSLAVRFMANEIKLKGS 241
            ....|.:.   |..:...:|.|::|....|...:...:.:..:||.|.|:..:......:..|..
Human   199 KRCLGALP---AACMLGPEGVPVSWVTMDPSCEIGMGYSVEKYRRRGNGTRLIMRCMKYLCQKNI 260

  Fly   242 EVLATVVPENEGSQKMFEKLGF 263
            ....:|:.||:|..:....|||
Human   261 PFYGSVLEENQGVIRKTSALGF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyatNP_001033883.2 RimI <155..264 CDD:223532 24/113 (21%)
NAT_SF 189..272 CDD:302625 16/75 (21%)
GLYATL1BNP_001342495.1 Gly_acyl_tr_N 10..207 CDD:310541 37/205 (18%)
NAT_SF 208..296 CDD:327402 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5417
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.