DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Pi15

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:199 Identity:55/199 - (27%)
Similarity:79/199 - (39%) Gaps:53/199 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SSIQSKKLKKDKKSLLKEFEIYKIPIIRRKP-IKQ----AVLRETNKYR-----RLHNANPLKMD 168
            ||:.:......:.:|....|...||..|||. |.|    |:|...|:.|     ...|...:..|
Mouse    41 SSLPANNFTDTEAALSTPLESADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWD 105

  Fly   169 EKLCSYAQEWA-----DHLADLNKLETRPNPLY-----GENIMRVRRSKF-SVDQILKLWYQEKY 222
            |.|...|:.||     ||           .|.|     |:| :.||..:: |:.|::|.||.|..
Mouse   106 ENLAKSAEAWAATCIWDH-----------GPSYLLRFLGQN-LSVRTGRYRSILQLVKPWYDEVK 158

  Fly   223 NYDYLKPG----------FNLYTGHFTQLVWRESEFLGVGV-ACDVSSIW---------IVCNYH 267
            :|.:..|.          |.....|:||:||..|..:|..: .|...::|         :||||.
Mouse   159 DYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYA 223

  Fly   268 PPGN 271
            |.||
Mouse   224 PKGN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/166 (27%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.