DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and PRY2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:58/184 - (31%)
Similarity:86/184 - (46%) Gaps:31/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 AAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLH-NANPLKM 167
            |:|...|:::|:..|      .:|...:|             ..:::.|.|..|.|| :...|..
Yeast   170 ASPTTATTTQSTASS------TQSSSSDF-------------STSMVNEHNTKRALHKDTGSLTW 215

  Fly   168 DEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFN 232
            .:.|.:|||.:||.......|.....| ||||:.....:..|||    .||.|..:|||..|||:
Yeast   216 SDTLATYAQNYADSYDCSGNLVHSGGP-YGENLALGYGTTGSVD----AWYNEITSYDYSNPGFS 275

  Fly   233 LYTGHFTQLVWRESEFLGVGV-ACDVSSIW---IVCNYHPPGNVSEHFRENVLP 282
            ...|||||:||:.:..:|.|: :|  ...|   |:|:|...|||...|.:||:|
Yeast   276 ESAGHFTQVVWKGTSEVGCGLKSC--GGEWGDYIICSYKAAGNVIGEFADNVMP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/130 (35%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.