DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and PRY3

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:55/137 - (40%)
Similarity:76/137 - (55%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VLRETNKYRRLH-NANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVDQ 212
            ||.|.||:|.|| :..||...:.|.:|||.:||.. |.:.:.|..:..||||:........:|| 
Yeast    29 VLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQY-DCSGVLTHSDGPYGENLALGYTDTGAVD- 91

  Fly   213 ILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVA-CDVS-SIWIVCNYHPPGNVSEH 275
               .||.|...|:|..|||:..||||||:||:.:..:|.|.. |..: :.:|||:|:||||....
Yeast    92 ---AWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGE 153

  Fly   276 FRENVLP 282
            |.|.|.|
Yeast   154 FAEEVEP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 50/125 (40%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 51/127 (40%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.