DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and PRY1

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:69/206 - (33%)
Similarity:91/206 - (44%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 STPNRSLNTEKDWSHGKRCLQCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIK 146
            |||..:..|.          |.||    |||.||..|.         |.:|             .
Yeast   135 STPAATTTTS----------QAAA----TSSASSSDSD---------LSDF-------------A 163

  Fly   147 QAVLRETNKYRRLHNANP-LKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSV 210
            .:||.|.||.|.||...| |...:.|.||||::||:. |.:...|.....||||:........:|
Yeast   164 SSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNY-DCSGTLTHSGGPYGENLALGYDGPAAV 227

  Fly   211 DQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGV-ACDVSSIW---IVCNYHPPGN 271
            |    .||.|..|||:..|||:..||||||:||:.:..:|.|: .|  ...|   ::|:|.|.||
Yeast   228 D----AWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTC--GGAWGDYVICSYDPAGN 286

  Fly   272 VSEHFRENVLP 282
            ....:.:||.|
Yeast   287 YEGEYADNVEP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 50/130 (38%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 51/129 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I1908
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm46540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.